Gene Name |
homothorax |
Gene Symbol |
hth |
Secondary ID |
CG17117 |
Synonyms |
1323/07 1422/04 CG17117 Dm-HTH Hth Meis1 P53 anon-EST:Liang-2.13 clone 2.13 dtl hth hth1 hth2 l(3)05745 l(3)86Ca |
Protein ID |
HTH_DROME |
Unipro ID |
O46339 |
FlyMine |
Link to FlyMine |
Primary DNAbindingDomain |
Homeobox |
Secondary DNAbindingDomain |
|
Pfam Domain |
Homeobox |
|
Motif |
Frequency Matrix |
Other Information |
|
|
Motif frequency in Drosophila genome |
Genome Surveyor |
Source |
B1H |
Sequence Method |
SOLEXA |
PubmedID |
18585360 |
Vector |
omegaUV2zf |
Inhibitor Concentration |
5 mM |
Inducer Concentration |
10 μM |
AA sequence of fragment |
NQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQ |
|
|
Motif |
Frequency Matrix |
Other Information |
|
|
Motif frequency in Drosophila genome |
Genome Surveyor |
Source |
B1H |
Sequence Method |
SOLEXA |
PubmedID |
|
Vector |
omegaUV2zf |
Inhibitor Concentration |
2 mM |
Inducer Concentration |
100 μM |
AA sequence of fragment |
NQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQ |
|
|
Motif |
Frequency Matrix |
Other Information |
|
|
Motif frequency in Drosophila genome |
Genome Surveyor |
Source |
B1H |
Sequence Method |
SANGER |
PubmedID |
18585360 |
Vector |
omegaUV2zf |
Inhibitor Concentration |
10 mM |
Inducer Concentration |
10 μM |
AA sequence of fragment |
NQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQ |
|
|