Gene Name |
extradenticle |
Gene Symbol |
exd |
Secondary ID |
CG8933 |
Synonyms |
CG8933 DExd Dm-EXD Dpbx EXD Exd Pbx1 anon-EST:fe1H3 exd l(1)IV td48 |
Protein ID |
EXD_DROME |
Unipro ID |
P40427 |
FlyMine |
Link to FlyMine |
Primary DNAbindingDomain |
Homeobox |
Secondary DNAbindingDomain |
|
Pfam Domain |
Homeobox; PBC |
|
Motif |
Frequency Matrix |
Other Information |
|
|
Motif frequency in Drosophila genome |
Genome Surveyor |
Source |
B1H |
Sequence Method |
SOLEXA |
PubmedID |
18585360 |
Vector |
omegaUV2zf |
Inhibitor Concentration |
5 mM |
Inducer Concentration |
10 μM |
AA sequence of fragment |
ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGAS |
|
|
Motif |
Frequency Matrix |
Other Information |
|
|
Motif frequency in Drosophila genome |
Genome Surveyor |
Source |
B1H |
Sequence Method |
SOLEXA |
PubmedID |
|
Vector |
omegaUV2zf |
Inhibitor Concentration |
2 mM |
Inducer Concentration |
100 μM |
AA sequence of fragment |
ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGAS |
|
|
Motif |
Frequency Matrix |
Other Information |
|
|
Motif frequency in Drosophila genome |
Genome Surveyor |
Source |
B1H |
Sequence Method |
SANGER |
PubmedID |
18585360 |
Vector |
omegaUV2zf |
Inhibitor Concentration |
10 mM |
Inducer Concentration |
10 μM |
AA sequence of fragment |
ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGAS |
|
|
Motif |
Frequency Matrix |
Other Information |
|
|
Motif frequency in Drosophila genome |
Genome Surveyor |
Source |
DNaseI |
Sequence Method |
SANGER |
PubmedID |
15572468 |
Vector |
|
Inhibitor Concentration |
|
Inducer Concentration |
|
AA sequence of fragment |
|
|
|