Gene Name |
pebbled |
Gene Symbol |
peb |
Secondary ID |
CG12212 |
Synonyms |
CG12212 EG:66A1.1 EP55 HNT Hind Hnt PEB anon-4Cg hnd hnt peb |
Protein ID |
O46205_DROME |
Unipro ID |
O46205 |
FlyMine |
Link to FlyMine |
Primary DNAbindingDomain |
zf-C2H2 |
Secondary DNAbindingDomain |
|
Pfam Domain |
zf-C2H2 |
|
Motif |
Frequency Matrix |
Other Information |
|
|
Motif frequency in Drosophila genome |
Genome Surveyor |
Source |
B1H |
Sequence Method |
SOLEXA |
PubmedID |
0 |
Vector |
omegaUV5 |
Inhibitor Concentration |
2.5 mM |
Inducer Concentration |
10 μM |
AA sequence of fragment |
KYLCPICEVVSATPHEFTNHIRCHNYANGDTENFTCRICSKVLSSASSLDRHVLVHTGERPFNCRYCHLTFTTNGNMHRHMRTHKQ |
|
|
Motif |
Frequency Matrix |
Other Information |
|
|
Motif frequency in Drosophila genome |
Genome Surveyor |
Source |
B1H |
Sequence Method |
SOLEXA |
PubmedID |
0 |
Vector |
omegaUV5 |
Inhibitor Concentration |
2.5 mM |
Inducer Concentration |
10 μM |
AA sequence of fragment |
FPCKLCTAVFPNLRALKGHNRVHLGAVGPAGPFRCNMCPYAVCDKAALVRHMRTHNGDRPYECAVCNYAFTTKANCERHLRNRHGKTSR |
|
|
Motif |
Frequency Matrix |
Other Information |
|
|
Motif frequency in Drosophila genome |
Genome Surveyor |
Source |
B1H |
Sequence Method |
SANGER |
PubmedID |
|
Vector |
omegaUV5 |
Inhibitor Concentration |
2.5 mM |
Inducer Concentration |
10 μM |
AA sequence of fragment |
KYLCPICEVVSATPHEFTNHIRCHNYANGDTENFTCRICSKVLSSASSLDRHVLVHTGERPFNCRYCHLTFTTNGNMHRHMRTHKQ |
|
|