Summary page for FlybaseID: FBgn0011278 from the database of Drosophila TF DNA-binding Specificities
Gene Name ladybird early
Gene Symbol lbe
Secondary ID CG6545
Synonyms CG6545 Hox11-D125 Lb Lbe NK? lb lbe
Protein ID Q61676_DROME
Unipro ID Q61676
FlyMine Link to FlyMine
Primary DNAbindingDomain Homeobox
Secondary DNAbindingDomain
Pfam Domain Homeobox
Motif Frequency Matrix Other Information
Logo
?
Motif frequency in Drosophila genome Genome Surveyor
Source B1H
Sequence Method SOLEXA
PubmedID 18585360
Vector omegaUV2zf
Inhibitor Concentration 5 mM
Inducer Concentration 10 μM
AA sequence of fragment

KRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIEELKKDFDSVK

Motif Frequency Matrix Other Information
Logo
?
Motif frequency in Drosophila genome Genome Surveyor
Source B1H
Sequence Method SANGER
PubmedID 18585360
Vector omegaUV2zf
Inhibitor Concentration 10 mM
Inducer Concentration 10 μM
AA sequence of fragment

KRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIEELKKDFDSVK