Summary page for FlybaseID: FBgn0016076 from the database of Drosophila TF DNA-binding Specificities
Gene Name vrille
Gene Symbol vri
Secondary ID CG14029
Synonyms CG14029 argo jf23 l(2)25Db l(2)jf23 mat(2)ea-G mat(2)earlyRS32 vri
Protein ID O18660_DROME
Unipro ID O18660
FlyMine Link to FlyMine
Primary DNAbindingDomain bZIP_2
Secondary DNAbindingDomain
Pfam Domain bZIP_2
Motif Frequency Matrix Other Information
Logo
?
Motif frequency in Drosophila genome Genome Surveyor
Source B1H
Sequence Method SANGER
PubmedID
Vector omegalppC
Inhibitor Concentration 5 mM
Inducer Concentration 10 μM
AA sequence of fragment

LTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKFNISGENLVSVEKILASLPTSEQVLSNTKRAK