Summary page for FlybaseID: FBgn0041092 from the database of Drosophila TF DNA-binding Specificities
Gene Name taiman
Gene Symbol tai
Secondary ID CG13109
Synonyms 58/2 CG13109 CG18494 DAIB1 DmTaiman EP(2)2630 NEST:bs13g05 bs13g05.y1 l(2)01351 l(2)k05802 l(2)k05809 tai
Protein ID Q9GS19_DROME
Unipro ID Q9GS19
FlyMine Link to FlyMine
Primary DNAbindingDomain
Secondary DNAbindingDomain
Pfam Domain HLH; PAS
Motif Frequency Matrix Other Information
Logo
?
Motif frequency in Drosophila genome Genome Surveyor
Source B1H
Sequence Method SANGER
PubmedID
Vector omegalppCdual
Inhibitor Concentration 5 mM
Inducer Concentration 10 μM
AA sequence of fragment

SGRKIRRKTDSKVNLPQSQINKCNNEKRRREA:MNTYINELSSMIPMCFAMQRKLDKLTVLRMAVQHLRGIRGSGSL

Heterodimeric partner for DNA binding